Structure of PDB 3l26 Chain A Binding Site BS01

Receptor Information
>3l26 Chain A (length=123) Species: 128952 (Ebola virus - Mayinga, Zaire, 1976) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASL
AEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPS
PKIDRGWVCVFQLQDGKTLGLKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3l26 Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
F239 S272 Q274 I340
Binding residue
(residue number reindexed from 1)
F22 S55 Q57 I123
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3l26, PDBe:3l26, PDBj:3l26
PDBsum3l26
PubMed20081868
UniProtQ05127|VP35_EBOZM Polymerase cofactor VP35 (Gene Name=VP35)

[Back to BioLiP]