Structure of PDB 3l0l Chain A Binding Site BS01

Receptor Information

>3l0l Chain A (length=247) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQR
KSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEV
VLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSAL
HFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQ
SILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFS

Ligand information

>3l0l Chain C (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EKHKILHRLLQDS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3l0l Structural basis for hydroxycholesterols as natural ligands of orphan nuclear receptor RORgamma.
Resolution	1.74 Å
Binding residue (original residue number in PDB)	K336 Q346 Q349 I350 P500 L501 E504 S507
Binding residue (residue number reindexed from 1)	K76 Q86 Q89 I90 P240 L241 E244 S247

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3l0l, PDBe:3l0l, PDBj:3l0l
PDBsum	3l0l
PubMed	20203100
UniProt	P51449\|RORG_HUMAN Nuclear receptor ROR-gamma (Gene Name=RORC)

[Back to BioLiP]