Structure of PDB 3l0e Chain A Binding Site BS01

Receptor Information
>3l0e Chain A (length=243) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLTAAQELMIQQLVAAQLQSNKRSFSDQPKVTPWPLGADPQSRDARQQRF
AHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETAR
RYNHETESITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMSSLGLDDA
EYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRF
PRMLMKLVSLRTLSSVHSEQVFALRLADAALPPLLSEIWDVHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3l0e Discovery of tertiary sulfonamides as potent liver X receptor antagonists.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		V283 K287 R297 E298 I301 K305 P451 L452 E455 D458 E461
Binding residue
(residue number reindexed from 1)		V65 K69 R79 E80 I83 K87 P233 L234 E237 D240 E243
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006629 lipid metabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3l0e, PDBe:3l0e, PDBj:3l0e
PDBsum3l0e
PubMed20345102
UniProtP55055|NR1H2_HUMAN Oxysterols receptor LXR-beta (Gene Name=NR1H2)

[Back to BioLiP]