Structure of PDB 3kze Chain A Binding Site BS01

Receptor Information
>3kze Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKK
GLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kze The Tiam1 PDZ domain couples to Syndecan1 and promotes cell-matrix adhesion.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		E849 K850 P918
Binding residue
(residue number reindexed from 1)		E12 K13 P81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005085 guanyl-nucleotide exchange factor activity
Biological Process
GO:0007264 small GTPase-mediated signal transduction
GO:0090630 activation of GTPase activity

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3kze, PDBe:3kze, PDBj:3kze
PDBsum3kze
PubMed20361982
UniProtQ13009|TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 (Gene Name=TIAM1)

[Back to BioLiP]