Structure of PDB 3kz0 Chain A Binding Site BS01

Receptor Information
>3kz0 Chain A (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DELYRQSLEIISRYLREQATGAKDGATSRKALETLRRVGDGVQRNHETAF
QGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHL
KTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kz0 Determinants of BH3 binding specificity for Mcl-1 versus Bcl-xL.
Resolution2.349 Å
Binding residue
(original residue number in PDB)		H224 A227 M231 K234 R248 V249 H252 V253 D256 N260 G262 R263 T266 L267 F318 F319 H320
Binding residue
(residue number reindexed from 1)		H46 A49 M53 K56 R70 V71 H74 V75 D78 N82 G84 R85 T88 L89 F140 F141 H142
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:3kz0, PDBe:3kz0, PDBj:3kz0
PDBsum3kz0
PubMed20363230
UniProtQ07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]