Structure of PDB 3kxt Chain A Binding Site BS01

Receptor Information
>3kxt Chain A (length=56) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKL
PDDYPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kxt Crystal structure of the crenarchaeal conserved chromatin protein Cren7 and double-stranded DNA complex
Resolution1.602 Å
Binding residue
(original residue number in PDB)		K24 W26 L28 A29 P30 K31 Y49 R51
Binding residue
(residue number reindexed from 1)		K20 W22 L24 A25 P26 K27 Y45 R47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3kxt, PDBe:3kxt, PDBj:3kxt
PDBsum3kxt
PubMed20512977
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]