Structure of PDB 3kww Chain A Binding Site BS01

Receptor Information
>3kww Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDRNTAIFKANTQTYRESLRNLRGYYNQSEAGSHIIQRMYG
CDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEARRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>3kww Chain C (length=13) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LPEPLPQGQLTAY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kww Hard wiring of T cell receptor specificity for the major histocompatibility complex is underpinned by TCR adaptability
Resolution2.18 Å
Binding residue
(original residue number in PDB)
M5 Y7 R62 N63 I66 F67 A69 N70 T73 Y74 S77 N80 Y84 R97 Y99 S116 T143 K146 W147 A150 R156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
M5 Y7 R62 N63 I66 F67 A69 N70 T73 Y74 S77 N80 Y84 R97 Y99 S116 T143 K146 W147 A150 R156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3kww, PDBe:3kww, PDBj:3kww
PDBsum3kww
PubMed20483993
UniProtP01889|HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain (Gene Name=HLA-B)

[Back to BioLiP]