Structure of PDB 3kuj Chain A Binding Site BS01

Receptor Information
>3kuj Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSEL
LHMLESPESLRSKVDEAVAVLQAHQAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kuj Molecular basis of eRF3 recognition by the MLLE domain of poly(A)-binding protein.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		Q560 G563 E564 F567 G579 K580 T582 G583 M584 E587 I588 K606 V613 H617
Binding residue
(residue number reindexed from 1)		Q17 G20 E21 F24 G36 K37 T39 G40 M41 E44 I45 K63 V70 H74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3kuj, PDBe:3kuj, PDBj:3kuj
PDBsum3kuj
PubMed20418951
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]