Structure of PDB 3kui Chain A Binding Site BS01

Receptor Information
>3kui Chain A (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELL
HMLESPESLRSKVDEAVAVLQAHQAKEAAQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kui Molecular basis of eRF3 recognition by the MLLE domain of poly(A)-binding protein.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Q560 G563 E564 G579 K580 T582 G583 M584 E587 K606 A610 H617
Binding residue
(residue number reindexed from 1)		Q16 G19 E20 G35 K36 T38 G39 M40 E43 K62 A66 H73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3kui, PDBe:3kui, PDBj:3kui
PDBsum3kui
PubMed20418951
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]