Structure of PDB 3ktr Chain A Binding Site BS01

Receptor Information
>3ktr Chain A (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSE
LLHMLESPESLRSKVDEAVAVLQAHQAKEAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ktr Structural basis of binding of P-body-associated proteins GW182 and ataxin-2 by the Mlle domain of poly(A)-binding protein.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		Q560 G563 E564 F567 P568 Q571 G579 K580 T582 M584 E587 A610 H617
Binding residue
(residue number reindexed from 1)		Q18 G21 E22 F25 P26 Q29 G37 K38 T40 M42 E45 A68 H75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3ktr, PDBe:3ktr, PDBj:3ktr
PDBsum3ktr
PubMed20181956
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]