Structure of PDB 3ktp Chain A Binding Site BS01

Receptor Information
>3ktp Chain A (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSEL
LHMLESPESLRSKVDEAVAVLQAHQAKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ktp Structural basis of binding of P-body-associated proteins GW182 and ataxin-2 by the Mlle domain of poly(A)-binding protein.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		Q556 Q560 G563 E564 F567 G579 T582 G583 M584 L586 H617
Binding residue
(residue number reindexed from 1)		Q13 Q17 G20 E21 F24 G36 T39 G40 M41 L43 H74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3ktp, PDBe:3ktp, PDBj:3ktp
PDBsum3ktp
PubMed20181956
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]