Structure of PDB 3kqi Chain A Binding Site BS01

Receptor Information
>3kqi Chain A (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIY
HCPNCEKTHGKSTLKKKRTWH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kqi Recognition of histone H3K4 trimethylation by the plant homeodomain of PHF2 modulates histone demethylation.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		Y7 Y14 T17 R18 F19 M20 I21 E22 W29 E39 D46
Binding residue
(residue number reindexed from 1)		Y9 Y16 T19 R20 F21 M22 I23 E24 W31 E41 D48
Enzymatic activity
Enzyme Commision number 1.14.11.-
Gene Ontology
Cellular Component
GO:0048188 Set1C/COMPASS complex

View graph for
Cellular Component
External links
PDB RCSB:3kqi, PDBe:3kqi, PDBj:3kqi
PDBsum3kqi
PubMed20129925
UniProtO75151|PHF2_HUMAN Lysine-specific demethylase PHF2 (Gene Name=PHF2)

[Back to BioLiP]