Structure of PDB 3kpn Chain A Binding Site BS01

Receptor Information
>3kpn Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAP
WIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYG
CDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kpn T cell allorecognition via molecular mimicry.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y7 Y9 K45 Y59 R62 E63 T69 E76 N77 I95 Y99 D116 Y123 T143 K146 W147 A150 V152 Q155 L156 Y159 S167 Y171
Binding residue
(residue number reindexed from 1)		Y7 Y9 K45 Y59 R62 E63 T69 E76 N77 I95 Y99 D116 Y123 T143 K146 W147 A150 V152 Q155 L156 Y159 S167 Y171
Enzymatic activity
Enzyme Commision number ?
External links