Structure of PDB 3knt Chain A Binding Site BS01

Receptor Information
>3knt Chain A (length=207) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MMLIKKIEELKNSEIKDIIDKRIQEFKSFKNKSNEEWFKELCFCILTANF
TAEGGIRIQKEIGDGFLTLPREELEEKLKNLGHRFYRKRAEYIVLARRFK
NIKDIVESFENEKVAREFLVRNIKGIGYQEASHFLRNVGYDDVAIIDRHI
LRELYENNYIDEIPKTLSRRKYLEIENILRDIGEEVNLKLSELDLYIWYL
RTGKVLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3knt The C-terminal Lysine of Ogg2 DNA Glycosylases is a Major Molecular Determinant for Guanine/8-Oxoguanine Distinction.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		T47 A48 N49 F50 T51 A52 R84 R89 K124 G125 G127 Q129 E130 I145 D147 R148 H149 R152 D194 W198 K207
Binding residue
(residue number reindexed from 1)		T47 A48 N49 F50 T51 A52 R84 R89 K124 G125 G127 Q129 E130 I145 D147 R148 H149 R152 D194 W198 K207
Enzymatic activity
Enzyme Commision number 3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0016829 lyase activity
GO:0140078 class I DNA-(apurinic or apyrimidinic site) endonuclease activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3knt, PDBe:3knt, PDBj:3knt
PDBsum3knt
PubMed20083120
UniProtQ58134|OGG1_METJA 8-oxoguanine DNA glycosylase/AP lyase (Gene Name=ogg)

[Back to BioLiP]