Structure of PDB 3kmt Chain A Binding Site BS01

Receptor Information
>3kmt Chain A (length=119) Species: 10506 (Paramecium bursaria Chlorella virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDY
LFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEE
ITISYGDDYWLSRPRLTQN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kmt Dimerization of a viral SET protein endows its function.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		N40 E48 D49 Y50 L51 F52 S53 R54 S58 H78 E79 L80 Y105 Y109 S112 R113
Binding residue
(residue number reindexed from 1)		N40 E48 D49 Y50 L51 F52 S53 R54 S58 H78 E79 L80 Y105 Y109 S112 R113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008168 methyltransferase activity
GO:0042802 identical protein binding
GO:0062122 histone H3K37 methyltransferase activity
Biological Process
GO:0006338 chromatin remodeling
GO:0032259 methylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3kmt, PDBe:3kmt, PDBj:3kmt
PDBsum3kmt
PubMed20937900
UniProtO41094

[Back to BioLiP]