Structure of PDB 3kmp Chain A Binding Site BS01

Receptor Information
>3kmp Chain A (length=124) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCP
GQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLEC
CEFPFGSKQKEVCINPYHYKRVES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kmp Structure of Smad1 MH1/DNA complex reveals distinctive rearrangements of BMP and TGF-beta effectors.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		S70 L71 Q76 K81
Binding residue
(residue number reindexed from 1)		S62 L63 Q68 K73
Binding affinityPDBbind-CN: Kd=111.9nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3kmp, PDBe:3kmp, PDBj:3kmp
PDBsum3kmp
PubMed20147459
UniProtP70340|SMAD1_MOUSE Mothers against decapentaplegic homolog 1 (Gene Name=Smad1)

[Back to BioLiP]