Structure of PDB 3kjp Chain A Binding Site BS01

Receptor Information

>3kjp Chain A (length=293) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNV
KLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLT
FEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSTLLKLCDV
QPMQYFDLTCQLLGKAEVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEGD
LSHIHRLQNLTIDILVYDNHVHVARSLKVGSFLRIYSLHTKLQSMNSENQ
TMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTA

Ligand information

>3kjp Chain B (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gttagggttag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3kjp How telomeric protein POT1 avoids RNA to achieve specificity for single-stranded DNA.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	F31 K33 Y36 S38 K39 G40 T41 D42 T48 L60 F62 Y89 Q94 Y161 Y223 D224 S243 H266 S270 Y271 R273
Binding residue (residue number reindexed from 1)	F26 K28 Y31 S33 K34 G35 T36 D37 T43 L55 F57 Y84 Q89 Y155 Y217 D218 S237 H260 S264 Y265 R267
Binding affinity	PDBbind-CN: Kd=6.3nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0043047	single-stranded telomeric DNA binding

	Biological Process
GO:0000723	telomere maintenance

	Cellular Component
GO:0000781	chromosome, telomeric region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3kjp, PDBe:3kjp, PDBj:3kjp
PDBsum	3kjp
PubMed	20080730
UniProt	Q9NUX5\|POTE1_HUMAN Protection of telomeres protein 1 (Gene Name=POT1)

[Back to BioLiP]