Structure of PDB 3ket Chain A Binding Site BS01

Receptor Information
>3ket Chain A (length=205) Species: 216495 (Streptococcus agalactiae serogroup III) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIPKATAKRLSLYYRIFKRFNTDGIEKASSKQIADALGIDSATVRRDFSY
FGELGRRGFGYDVKKLMNFFAEILNDHSTTNVMLVGCGNIGRALLHYRFH
DRNKMQISMAFDLDSNDLVGKTTEDGIPVYGISTINDHLIDSDIETAILT
VPSTEAQEVADILVKAGIKGILSFSPVHLTLPKDIIVQYVDLTSELQTLL
YFMNQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ket NAD+ pool depletion as a signal for the Rex regulon involved in Streptococcus agalactiae virulence.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		S34 S35 R50 R51 E58 G60 R61 R62 G63 F64 G65 Y66
Binding residue
(residue number reindexed from 1)		S29 S30 R45 R46 E53 G55 R56 R57 G58 F59 G60 Y61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0051775 response to redox state
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ket, PDBe:3ket, PDBj:3ket
PDBsum3ket
PubMed34370789
UniProtQ8E565|REX_STRA3 Redox-sensing transcriptional repressor Rex (Gene Name=rex)

[Back to BioLiP]