Structure of PDB 3kd7 Chain A Binding Site BS01

Receptor Information
>3kd7 Chain A (length=102) Species: 32644 (unidentified) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQ
GDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALEL
DP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kd7 Crystal structure of a designed tetratricopeptide repeat module in complex with its peptide ligand.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		Y20 K78 R82
Binding residue
(residue number reindexed from 1)		Y14 K72 R76
External links