Structure of PDB 3k7z Chain A Binding Site BS01

Receptor Information
>3k7z Chain A (length=31) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMKQLEDKVEELLSKAYHLENEVARLKKLVG
Ligand information
>3k7z Chain C (length=29) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KQLEDKVEELLSKAYHLENEVARLKKLVG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3k7z Automated Protein Crystal Structure Determination Using Elves.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		M2 E6 L12 L13 A16 E20 V23 K27
Binding residue
(residue number reindexed from 1)		M2 E6 L12 L13 A16 E20 V23 K27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3k7z, PDBe:3k7z, PDBj:3k7z
PDBsum3k7z
PubMed14752198
UniProtP03069|GCN4_YEAST General control transcription factor GCN4 (Gene Name=GCN4)

[Back to BioLiP]