Structure of PDB 3k47 Chain A Binding Site BS01

Receptor Information
>3k47 Chain A (length=186) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLV
IMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLI
EQPELASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPE
IDLGKYKLLPEYPGVLSEVQEEKGIKYKFEVYEKKD
Ligand information
Ligand IDD09
InChIInChI=1S/C16H16N4O2/c1-9(11-5-3-4-6-12(11)21-2)7-10-8-22-15-13(10)14(17)19-16(18)20-15/h3-8H,1-2H3,(H4,17,18,19,20)/b9-7+
InChIKeyJXICVPBZQSPDOK-VQHVLOKHSA-N
SMILES
SoftwareSMILES
CACTVS 3.370COc1ccccc1\C(C)=C\c2coc3nc(N)nc(N)c23
ACDLabs 12.01n1c(c2c(nc1N)occ2\C=C(\c3ccccc3OC)C)N
CACTVS 3.370COc1ccccc1C(C)=Cc2coc3nc(N)nc(N)c23
OpenEye OEToolkits 1.7.0CC(=Cc1coc2c1c(nc(n2)N)N)c3ccccc3OC
OpenEye OEToolkits 1.7.0C/C(=C\c1coc2c1c(nc(n2)N)N)/c3ccccc3OC
FormulaC16 H16 N4 O2
Name5-[(1E)-2-(2-methoxyphenyl)prop-1-en-1-yl]furo[2,3-d]pyrimidine-2,4-diamine
ChEMBLCHEMBL610181
DrugBank
ZINCZINC000034074108
PDB chain3k47 Chain A Residue 188 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3k47 Design, synthesis, and X-ray crystal structures of 2,4-diaminofuro[2,3-d]pyrimidines as multireceptor tyrosine kinase and dihydrofolate reductase inhibitors.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		I7 V8 A9 E30 F31 F34 I60 V115
Binding residue
(residue number reindexed from 1)		I7 V8 A9 E30 F31 F34 I60 V115
Annotation score1
Binding affinityMOAD: ic50=14.5uM
BindingDB: IC50=14500nM
Enzymatic activity
Catalytic site (original residue number in PDB) L22 W24 E30 F31 F34 L67 M111 T136
Catalytic site (residue number reindexed from 1) L22 W24 E30 F31 F34 L67 M111 T136
Enzyme Commision number 1.5.1.3: dihydrofolate reductase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0004146 dihydrofolate reductase activity
GO:0016491 oxidoreductase activity
GO:0050661 NADP binding
GO:0051871 dihydrofolic acid binding
Biological Process
GO:0006729 tetrahydrobiopterin biosynthetic process
GO:0006730 one-carbon metabolic process
GO:0031103 axon regeneration
GO:0031427 response to methotrexate
GO:0035094 response to nicotine
GO:0035999 tetrahydrofolate interconversion
GO:0046452 dihydrofolate metabolic process
GO:0046653 tetrahydrofolate metabolic process
GO:0046654 tetrahydrofolate biosynthetic process
GO:0046655 folic acid metabolic process
GO:0051000 positive regulation of nitric-oxide synthase activity
GO:2000121 regulation of removal of superoxide radicals
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3k47, PDBe:3k47, PDBj:3k47
PDBsum3k47
PubMed19748785
UniProtP00375|DYR_MOUSE Dihydrofolate reductase (Gene Name=Dhfr)

[Back to BioLiP]