Structure of PDB 3k16 Chain A Binding Site BS01

Receptor Information
>3k16 Chain A (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCE
RTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQG
PKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSF
TLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLTSVALYQCQ
ELDTYLIPQIP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3k16 Comparison of the Structures and Peptide Binding Specificities of the BRCT Domains of MDC1 and BRCA1
Resolution3.0 Å
Binding residue
(original residue number in PDB)		S1655 G1656 R1699 T1700 K1702 N1774 M1775
Binding residue
(residue number reindexed from 1)		S7 G8 R51 T52 K54 N126 M127
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004842 ubiquitin-protein transferase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006281 DNA repair
GO:0006974 DNA damage response
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3k16, PDBe:3k16, PDBj:3k16
PDBsum3k16
PubMed20159462
UniProtP38398|BRCA1_HUMAN Breast cancer type 1 susceptibility protein (Gene Name=BRCA1)

[Back to BioLiP]