Structure of PDB 3k05 Chain A Binding Site BS01

Receptor Information
>3k05 Chain A (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCA
LGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRA
RERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVI
TCPQDFPHCSIPLRVGLPLLSPEFLLDGVLKQEAKPEAFVLSP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3k05 Comparison of the Structures and Peptide Binding Specificities of the BRCT Domains of MDC1 and BRCA1
Resolution1.33 Å
Binding residue
(original residue number in PDB)
T1898 G1899 R1932 R1933 T1934 K1936 P2009
Binding residue
(residue number reindexed from 1)
T8 G9 R42 R43 T44 K46 P119
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3k05, PDBe:3k05, PDBj:3k05
PDBsum3k05
PubMed20159462
UniProtQ14676|MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 (Gene Name=MDC1)

[Back to BioLiP]