Structure of PDB 3jzh Chain A Binding Site BS01

Receptor Information
>3jzh Chain A (length=359) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQG
EIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITM
QCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFG
GVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDY
NPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVC
WKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALG
NQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCD
DASIWRWDR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jzh Binding of different histone marks differentially regulates the activity and specificity of polycomb repressive complex 2 (PRC2).
Resolution2.05 Å
Binding residue
(original residue number in PDB)		F97 Y148 Y308 C324 I363 W364 Y365 R414
Binding residue
(residue number reindexed from 1)		F17 Y68 Y228 C244 I283 W284 Y285 R334
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001222 transcription corepressor binding
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0031491 nucleosome binding
GO:0042802 identical protein binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0021510 spinal cord development
GO:0031507 heterochromatin formation
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol
GO:0035098 ESC/E(Z) complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jzh, PDBe:3jzh, PDBj:3jzh
PDBsum3jzh
PubMed20974918
UniProtO75530|EED_HUMAN Polycomb protein EED (Gene Name=EED)

[Back to BioLiP]