Structure of PDB 3jy1 Chain A Binding Site BS01

Receptor Information

>3jy1 Chain A (length=226) Species: 222523 (Bacillus cereus ATCC 10987) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PMHPFVKALQEHFTAHQNPEKAEPMARYMKNHFLFLGIQTPERRQLLKDI
IQIHTLPDQKDFQIIIRELWDLPEREFQAAALDIMQKYKKHINETHIPFL
EELIVTKSWWDSVDSIVPTFLGDIFLKHPELISAYIPKWIASDNIWLQRA
AILFQLKYKQKMDEELLFWIIGQLHSSKEFFIQKAIGWVLREYAKTNPDV
VWEYVQNNELAPLSKREAIKHIKQNY

Ligand information

>3jy1 Chain B (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgggcggctt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3jy1 An unprecedented nucleic acid capture mechanism for excision of DNA damage.
Resolution	1.754 Å
Binding residue (original residue number in PDB)	Q38 T39 R43 R215 K222
Binding residue (residue number reindexed from 1)	Q39 T40 R44 R216 K223

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:3jy1, PDBe:3jy1, PDBj:3jy1
PDBsum	3jy1
PubMed	20927102
UniProt	Q816E8

[Back to BioLiP]