Structure of PDB 3jy0 Chain A Binding Site BS01

Receptor Information

>3jy0 Chain A (length=275) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPN
GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDF
ITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGEL
KLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILL
YDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFE
EIQNHPWMQDVLLPQETAEIHLHSL

Ligand information

Ligand ID

LYG

InChI

InChI=1S/C15H14ClN3O2S/c16-8-1-2-11-10(5-8)13-14(22-11)15(21)18-12(17-13)7-19-4-3-9(20)6-19/h1-2,5,9,20H,3-4,6-7H2,(H,17,18,21)/t9-/m0/s1

InChIKey

DSUSQUXNJRQJMI-VIFPVBQESA-N

SMILES

Software	SMILES
OpenEye OEToolkits 1.7.0	c1cc2c(cc1Cl)c3c(s2)C(=O)NC(=N3)CN4CCC(C4)O
ACDLabs 11.02	Clc4cc3c(sc1c3N=C(NC1=O)CN2CCC(O)C2)cc4
OpenEye OEToolkits 1.7.0	c1cc2c(cc1Cl)c3c(s2)C(=O)NC(=N3)C[N@@]4CC[C@@H](C4)O
CACTVS 3.352	O[CH]1CCN(C1)CC2=Nc3c(sc4ccc(Cl)cc34)C(=O)N2
CACTVS 3.352	O[C@H]1CCN(C1)CC2=Nc3c(sc4ccc(Cl)cc34)C(=O)N2

Formula

C15 H14 Cl N3 O2 S

Name

8-chloro-2-{[(3S)-3-hydroxypyrrolidin-1-yl]methyl}[1]benzothieno[3,2-d]pyrimidin-4(3H)-one

PDB chain

3jy0 Chain A Residue 1000 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3jy0 Discovery of 3H-benzo[4,5]thieno[3,2-d]pyrimidin-4-ones as Potent, Highly Selective and Orally Bioavailable Pim Kinases Inhibitors
Resolution	2.4 Å
Binding residue (original residue number in PDB)	V52 A65 K67 E121 N172 L174 I185 D186
Binding residue (residue number reindexed from 1)	V20 A33 K35 E89 N140 L142 I153 D154
Annotation score	1
Binding affinity	PDBbind-CN: -logKd/Ki=8.30,Ki=5nM BindingDB: Ki=5nM

Enzymatic activity

Catalytic site (original residue number in PDB)	D167 K169 N172 D186 L193 T204
Catalytic site (residue number reindexed from 1)	D135 K137 N140 D154 L161 T172
Enzyme Commision number	2.7.11.1: non-specific serine/threonine protein kinase.

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008134	transcription factor binding
GO:0030145	manganese ion binding
GO:0043024	ribosomal small subunit binding
GO:0044024	histone H2AS1 kinase activity
GO:0046872	metal ion binding
GO:0106310	protein serine kinase activity

	Biological Process
GO:0006338	chromatin remodeling
GO:0006468	protein phosphorylation
GO:0006915	apoptotic process
GO:0016310	phosphorylation
GO:0022898	regulation of transmembrane transporter activity
GO:0043066	negative regulation of apoptotic process
GO:0043433	negative regulation of DNA-binding transcription factor activity
GO:0045824	negative regulation of innate immune response
GO:0045893	positive regulation of DNA-templated transcription
GO:0046777	protein autophosphorylation
GO:0050821	protein stabilization
GO:0060045	positive regulation of cardiac muscle cell proliferation
GO:0070561	vitamin D receptor signaling pathway
GO:0071346	cellular response to type II interferon
GO:0090336	positive regulation of brown fat cell differentiation
GO:1902033	regulation of hematopoietic stem cell proliferation
GO:1904263	positive regulation of TORC1 signaling
GO:1905062	positive regulation of cardioblast proliferation
GO:1990748	cellular detoxification

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005886	plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jy0, PDBe:3jy0, PDBj:3jy0
PDBsum	3jy0
PubMed
UniProt	P11309\|PIM1_HUMAN Serine/threonine-protein kinase pim-1 (Gene Name=PIM1)

[Back to BioLiP]