Structure of PDB 3jxy Chain A Binding Site BS01

Receptor Information

>3jxy Chain A (length=231) Species: 222523 (Bacillus cereus ATCC 10987) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PMHPFVKALQEHFTAHQNPEKAEPMARYMKNHFLFLGIQTPERRQLLKDI
IQIHTLPDQKDFQIIIRELWDLPEREFQAAALDIMQKYKKHINETHIPFL
EELIVTKSWWDSVDSIVPTFLGDIFLKHPELISAYIPKWIASDNIWLQRA
AILFQLKYKQKMDEELLFWIIGQLHSSKEFFIQKAIGWVLREYAKTNPDV
VWEYVQNNELAPLSKREAIKHIKQNYGINNE

Ligand information

>3jxy Chain B (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cggactgacggg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3jxy An unprecedented nucleic acid capture mechanism for excision of DNA damage.
Resolution	1.5 Å
Binding residue (original residue number in PDB)	T39 R43 R215
Binding residue (residue number reindexed from 1)	T40 R44 R216

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:3jxy, PDBe:3jxy, PDBj:3jxy
PDBsum	3jxy
PubMed	20927102
UniProt	Q816E8

[Back to BioLiP]