Structure of PDB 3jvk Chain A Binding Site BS01

Receptor Information
>3jvk Chain A (length=128) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMGSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVD
AVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYI
YNKPGDDIVLMAEALEKLFLQKINELPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jvk Structures of the Dual Bromodomains of the P-TEFb-activating Protein Brd4 at Atomic Resolution
Resolution1.8 Å
Binding residue
(original residue number in PDB)
L94 N140 I146
Binding residue
(residue number reindexed from 1)
L56 N102 I108
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3jvk, PDBe:3jvk, PDBj:3jvk
PDBsum3jvk
PubMed19828451
UniProtQ9ESU6|BRD4_MOUSE Bromodomain-containing protein 4 (Gene Name=Brd4)

[Back to BioLiP]