Structure of PDB 3jso Chain A Binding Site BS01

Receptor Information
>3jso Chain A (length=188) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALA
RKGVIEIVSGASRGIRLLGLPLVGRVAAGEPLIEGHYQVDPSLFKPNADF
LLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVARLKKQ
GNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jso Structure of the LexA-DNA complex and implications for SOS box measurement.
Resolution2.29 Å
Binding residue
(original residue number in PDB)
T5 R7 F37 R38 S39 N41 A42 E45 H46 G61 A62 S63
Binding residue
(residue number reindexed from 1)
T4 R6 F36 R37 S38 N40 A41 E44 H45 G60 A61 S62
Binding affinityPDBbind-CN: Kd=0.80nM
Enzymatic activity
Catalytic site (original residue number in PDB) M118 S119 E152 A156
Catalytic site (residue number reindexed from 1) M107 S108 E141 A145
Enzyme Commision number 3.4.21.88: repressor LexA.
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0042802 identical protein binding
Biological Process
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006508 proteolysis
GO:0006974 DNA damage response
GO:0009432 SOS response
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3jso, PDBe:3jso, PDBj:3jso
PDBsum3jso
PubMed20703307
UniProtP0A7C2|LEXA_ECOLI LexA repressor (Gene Name=lexA)

[Back to BioLiP]