Structure of PDB 3jr3 Chain A Binding Site BS01

Receptor Information
>3jr3 Chain A (length=238) Species: 2336 (Thermotoga maritima) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKMKEFLDLLNESRLTVTLTGAGISTPSGIPDFKYSQNVFDIDFFYSHPE
EFYRFAKEGIFPMLQAKPNLAHVLLAKLEEKGLIEAVITQNIDRLHQRAG
SKKVIELAGNVEEYYCVRCEKKYTVEDVIKKLESSDVPLCDDCNSLIRPN
IVFFGENLPQDALREAIGLSSRASLMIVLGSSLVVYPAAELPLITVRSGG
KLVIVNLGETPFDDIATLKYNMDVVEFARRVMEEGGIS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jr3 Structure-based mechanism of ADP-ribosylation by sirtuins.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		V160 F162 G163 E164 N165 L166 L171 V193 Y194 P195
Binding residue
(residue number reindexed from 1)		V152 F154 G155 E156 N157 L158 L163 V185 Y186 P187
Enzymatic activity
Catalytic site (original residue number in PDB) P31 D32 F33 N99 D101 A116
Catalytic site (residue number reindexed from 1) P31 D32 F33 N91 D93 A108
Enzyme Commision number 2.3.1.286: protein acetyllysine N-acetyltransferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0016740 transferase activity
GO:0017136 NAD-dependent histone deacetylase activity
GO:0034979 NAD-dependent protein lysine deacetylase activity
GO:0046872 metal ion binding
GO:0051287 NAD binding
GO:0070403 NAD+ binding
Biological Process
GO:0006338 chromatin remodeling
GO:0006476 protein deacetylation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jr3, PDBe:3jr3, PDBj:3jr3
PDBsum3jr3
PubMed19801667
UniProtQ9WYW0|NPD_THEMA NAD-dependent protein deacetylase (Gene Name=cobB)

[Back to BioLiP]