Structure of PDB 3ivv Chain A Binding Site BS01

Receptor Information
>3ivv Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKG
LDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRF
VQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ivv Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of BTB-Cul3 Ubiquitin Ligases.
Resolution1.25 Å
Binding residue
(original residue number in PDB)
L76 Y87 Y123 K129 D130 W131 G132 F133
Binding residue
(residue number reindexed from 1)
L51 Y62 Y98 K104 D105 W106 G107 F108
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3ivv, PDBe:3ivv, PDBj:3ivv
PDBsum3ivv
PubMed19818708
UniProtO43791|SPOP_HUMAN Speckle-type POZ protein (Gene Name=SPOP)

[Back to BioLiP]