Structure of PDB 3ivq Chain A Binding Site BS01

Receptor Information
>3ivq Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGAKLKWCLRVNPKGL
DEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFV
QGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ivq Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of BTB-Cul3 Ubiquitin Ligases.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R70 L76 Y87 Y123 G128 K129 D130 W131 G132
Binding residue
(residue number reindexed from 1)		R44 L50 Y61 Y97 G102 K103 D104 W105 G106
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3ivq, PDBe:3ivq, PDBj:3ivq
PDBsum3ivq
PubMed19818708
UniProtO43791|SPOP_HUMAN Speckle-type POZ protein (Gene Name=SPOP)

[Back to BioLiP]