Structure of PDB 3ivb Chain A Binding Site BS01

Receptor Information
>3ivb Chain A (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLD
EESKDYLSLYLLLVSCPKEVRAKFKFSILNAKGEETKAMESQRAYRFVQG
KDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ivb Structure 9
Resolution1.75 Å
Binding residue
(original residue number in PDB)		Y87 R124 V126 K129 D130 W131 G132 F133 K134
Binding residue
(residue number reindexed from 1)		Y60 R96 V98 K101 D102 W103 G104 F105 K106
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3ivb, PDBe:3ivb, PDBj:3ivb
PDBsum3ivb
PubMed
UniProtO43791|SPOP_HUMAN Speckle-type POZ protein (Gene Name=SPOP)

[Back to BioLiP]