Structure of PDB 3isw Chain A Binding Site BS01

Receptor Information

>3isw Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISF
EDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASP

Ligand information

>3isw Chain C (length=18) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PLEKASVVSKLFFSWTAP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3isw Biochemical basis of the interaction between cystic fibrosis transmembrane conductance regulator and immunoglobulin-like repeats of filamin.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	G2267 A2268 G2269 G2270 L2271 A2272 I2273 A2274 V2275 E2276 G2277 P2278 S2279 K2280 A2281 I2283 F2285
Binding residue (residue number reindexed from 1)	G32 A33 G34 G35 L36 A37 I38 A39 V40 E41 G42 P43 S44 K45 A46 I48 F50

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0051015	actin filament binding

	Biological Process
GO:0030036	actin cytoskeleton organization

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3isw, PDBe:3isw, PDBj:3isw
PDBsum	3isw
PubMed	20351101
UniProt	P21333\|FLNA_HUMAN Filamin-A (Gene Name=FLNA)

[Back to BioLiP]