Structure of PDB 3ips Chain A Binding Site BS01

Receptor Information
>3ips Chain A (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLSPEQLGMIEKLVAAQQVTPWPSREARQQRFAHFTELAIVSVQEIVDFA
KQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYN
REDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNV
QDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHS
EQVFALRLQDKKLPPLLSEIWDVH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ips X-ray structures of the LXRalpha LBD in its homodimeric form and implications for heterodimer signaling.
Resolution2.26 Å
Binding residue
(original residue number in PDB)		V269 K273 E284 I287 A288 K291 P437 L438 E441
Binding residue
(residue number reindexed from 1)		V47 K51 E62 I65 A66 K69 P215 L216 E219
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006629 lipid metabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3ips, PDBe:3ips, PDBj:3ips
PDBsum3ips
PubMed20382159
UniProtQ13133|NR1H3_HUMAN Oxysterols receptor LXR-alpha (Gene Name=NR1H3)

[Back to BioLiP]