Structure of PDB 3ioz Chain A Binding Site BS01

Receptor Information

>3ioz Chain A (length=109) Species: 388909 (Simian immunodeficiency virus - cpz) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PLRTMSYKLAIDMSHFIKEKGGLEGIYYSARRHRILDIYLEKEEGIIPDW
QDYTSGPGIRYPKTFGWLWKLVPVTSQWDDPWGEVLAWKFDPTLAYTYEA
YVRYPEEFG

Ligand information

>3ioz Chain B (length=16) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AYQQGQNQLYNELNLG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3ioz Pseudo-merohedral twinning and noncrystallographic symmetry in orthorhombic crystals of SIVmac239 Nef core domain bound to different-length TCRzeta fragments.
Resolution	3.699 Å
Binding residue (original residue number in PDB)	K126 G127 I132 R137 R138 Y145 K148 E149
Binding residue (residue number reindexed from 1)	K20 G21 I26 R31 R32 Y39 K42 E43

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005525	GTP binding

View graph for
Molecular Function

External links

PDB	RCSB:3ioz, PDBe:3ioz, PDBj:3ioz
PDBsum	3ioz
PubMed	20124696
UniProt	Q5QGG3

[Back to BioLiP]