Structure of PDB 3io9 Chain A Binding Site BS01

Receptor Information
>3io9 Chain A (length=142) Species: 9606,10090 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDLYRQSLEIISRYLREQATGSGAAGRRALETLRRVGDGVQRNHETAFQG
MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKT
INQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVE
Ligand information
>3io9 Chain B (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RPEIWIAQEYRRIGDEFNAYYAR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3io9 Conformational changes in Bcl-2 pro-survival proteins determine their capacity to bind ligands.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		V220 H224 G230 M231 K234 V249 H252 V253 D256 N260 G262 R263 T266 L267 F270 F318 F319
Binding residue
(residue number reindexed from 1)		V40 H44 G50 M51 K54 V69 H72 V73 D76 N80 G82 R83 T86 L87 F90 F138 F139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:3io9, PDBe:3io9, PDBj:3io9
PDBsum3io9
PubMed19726685
UniProtP97287|MCL1_MOUSE Induced myeloid leukemia cell differentiation protein Mcl-1 homolog (Gene Name=Mcl1);
Q07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]