Structure of PDB 3im4 Chain A Binding Site BS01

Receptor Information
>3im4 Chain A (length=50) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK
Ligand information
>3im4 Chain C (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DEAQEELAWKIAKMIVSDVMQQAQYDQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3im4 Structure of D-AKAP2:PKA RI Complex: Insights into AKAP Specificity and Selectivity
Resolution2.285 Å
Binding residue
(original residue number in PDB)		L13 E17 Q26 A27 K30 I33
Binding residue
(residue number reindexed from 1)		L2 E6 Q15 A16 K19 I22
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3im4, PDBe:3im4, PDBj:3im4
PDBsum3im4
PubMed20159461
UniProtP00514|KAP0_BOVIN cAMP-dependent protein kinase type I-alpha regulatory subunit (Gene Name=PRKAR1A)

[Back to BioLiP]