Structure of PDB 3iin Chain A Binding Site BS01

Receptor Information
>3iin Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRG
QAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Ligand information
>3iin Chain B (length=197) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggccgugugccuugcgccgggaaaccacgcaagggauggugucaaauucg
gcgaaaccuaagcgcccgcccgggcguauggcaacgccgagccaagcuuc
gcagccauugcacuccggcugcgaugaagguguagagacuagacggcacc
caccuaaggcaaacgcuauggugaaggcauaguccagggaguggcga
.........<<<<<<<..<<....>>.>>>>>>>...<<<<<<....<<<
<<<...<<...<<<<<......>>>>>..>>...>>>>>><<<.....<<
<<<<<<..........>>>>>>>>....>>>.....(((((...>>>>>>
<<<<...<<<....>>>..>>>>......))))).............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3iin Plasticity of the RNA kink turn structural motif.
Resolution4.18 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 K22 L49 K50 M51 R52 Q54 F56 R83 A87 K88 S91 D92
Binding residue
(residue number reindexed from 1)		Y10 N12 N13 E16 K19 L46 K47 M48 R49 Q51 F53 R80 A84 K85 S88 D89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3iin, PDBe:3iin, PDBj:3iin
PDBsum3iin
PubMed20145044
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]