Structure of PDB 3idn Chain A Binding Site BS01

Receptor Information

>3idn Chain A (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALQLTQSPSSLSASVGDRITITCRASQGVTSALAWYRQKPGSPPQLLIYD
ASSLESGVPSRFSGSGSGTEFTLTISTLRPEDFATYYCQQLHFYPHTFGG
GTRVDVRRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYECEVTHQG
LSSPVTKSFNRGEC

Ligand information

>3idn Chain C (length=7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ELDFWAS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3idn Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
Resolution	2.25 Å
Binding residue (original residue number in PDB)	L91 H92 F93 Y94 H96
Binding residue (residue number reindexed from 1)	L91 H92 F93 Y94 H96

External links

PDB	RCSB:3idn, PDBe:3idn, PDBj:3idn
PDBsum	3idn
PubMed	19740978

[Back to BioLiP]