Structure of PDB 3ibc Chain A Binding Site BS01

Receptor Information
>3ibc Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGF
DVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGV
TPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ibc Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		R87 G145 Q184 C186
Binding residue
(residue number reindexed from 1)		R31 G89 Q128 C130
Enzymatic activity
Catalytic site (original residue number in PDB) G85 V86 G145 C186
Catalytic site (residue number reindexed from 1) G29 V30 G89 C130
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3ibc, PDBe:3ibc, PDBj:3ibc
PDBsum3ibc
PubMed19655253
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]