Structure of PDB 3i90 Chain A Binding Site BS01

Receptor Information
>3i90 Chain A (length=50) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3i90 Recognition and specificity determinants of the human cbx chromodomains.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R9 V10 F11 A12 W32 W35 E43 N47 L49 D50 R52 L53
Binding residue
(residue number reindexed from 1)		R1 V2 F3 A4 W24 W27 E35 N39 L41 D42 R44 L45
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3i90, PDBe:3i90, PDBj:3i90
PDBsum3i90
PubMed21047797
UniProtO95503|CBX6_HUMAN Chromobox protein homolog 6 (Gene Name=CBX6)

[Back to BioLiP]