Structure of PDB 3i6k Chain A Binding Site BS01

Receptor Information
>3i6k Chain A (length=273) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYG
CDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAA
HVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEAT
LRCWALSFYPAEITLTWQRDGEDQTTELVETRPAGDGTFQKWAAVVVPSG
QEQRYTCHVQHEGLPKPLTLRWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3i6k The membrane protein of severe acute respiratory syndrome coronavirus acts as a dominant immunogen revealed by a clustering region of novel functionally and structurally defined cytotoxic T-lymphocyte epitopes
Resolution2.8 Å
Binding residue
(original residue number in PDB)
Y7 E63 K66 V67 H70 T73 D77 Y84 Y99 Y116 T143 K146 W147 Q155 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 E63 K66 V67 H70 T73 D77 Y84 Y99 Y116 T143 K146 W147 Q155 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3i6k, PDBe:3i6k, PDBj:3i6k
PDBsum3i6k
PubMed20831383
UniProtP04439|HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain (Gene Name=HLA-A)

[Back to BioLiP]