Structure of PDB 3i5r Chain A Binding Site BS01

Receptor Information
>3i5r Chain A (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPE
EIGWLNGYNETTGERGDFPGTYVEYIGRKKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3i5r Structural studies of the phosphatidylinositol 3-kinase (PI3K) SH3 domain in complex with a peptide ligand: role of the anchor residue in ligand binding.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		Y12 R18 D21 W55 P70 T72 Y73
Binding residue
(residue number reindexed from 1)		Y11 R17 D20 W54 P69 T71 Y72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3i5r, PDBe:3i5r, PDBj:3i5r
PDBsum3i5r
PubMed19919182
UniProtP27986|P85A_HUMAN Phosphatidylinositol 3-kinase regulatory subunit alpha (Gene Name=PIK3R1)

[Back to BioLiP]