Structure of PDB 3i1h Chain A Binding Site BS01

Receptor Information
>3i1h Chain A (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CEFGYIYRLAQDYLQCVLQIPPSKTSRVLQNVAFSVQKEVEKNLKSCLDN
VNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQI
APDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3i1h crystal structure of human BFL-1 in complex with BAK BH3 peptide
Resolution2.2 Å
Binding residue
(original residue number in PDB)		V48 L52 C55 V74 K77 E78 D81 N85 G87 R88 T91 F95 K147
Binding residue
(residue number reindexed from 1)		V40 L44 C47 V66 K69 E70 D73 N77 G79 R80 T83 F87 K139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:3i1h, PDBe:3i1h, PDBj:3i1h
PDBsum3i1h
PubMed
UniProtQ16548|B2LA1_HUMAN Bcl-2-related protein A1 (Gene Name=BCL2A1)

[Back to BioLiP]