Structure of PDB 3hxo Chain A Binding Site BS01

Receptor Information
>3hxo Chain A (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVV
EYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIF
SKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPH
ANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPT
Ligand information
>3hxo Chain B (length=40) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcgtgcagtgccttcggccgtgcggtgcctccgtcacgc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3hxo A structural explanation for the antithrombotic activity of ARC1172, a DNA aptamer that binds von Willebrand factor domain A1.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		K599 F603 Q625 E626 Q628 R629 S631 R632 N633 Y637 A657 L659 K660
Binding residue
(residue number reindexed from 1)		K93 F97 Q119 E120 Q122 R123 S125 R126 N127 Y131 A151 L153 K154
Binding affinityPDBbind-CN: Kd=0.6nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3hxo, PDBe:3hxo, PDBj:3hxo
PDBsum3hxo
PubMed19913482
UniProtP04275|VWF_HUMAN von Willebrand factor (Gene Name=VWF)

[Back to BioLiP]