Structure of PDB 3hxi Chain A Binding Site BS01

Receptor Information
>3hxi Chain A (length=182) Species: 6183 (Schistosoma mansoni) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFPHPLQDSWSYYLFQFRKALDWDECLEKVATFSTIEDFWSVLTHTVRPR
EITYGKDLYMFKSDIMPKWEDPKNENGGRWLINVTARQDVDFLWDELLML
LIGSDWDTDEEDRQICGAVFQPRSRGSKLSVWLTSDNEEETILSIGRRIK
ERLELEDTIYFQPVSDQRSQTRGSDCTGKYEI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3hxi Structural insights into parasite EIF4E binding specificity for m7G and m2,2,7G mRNA cap.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
H24 P25 Q27 I56 W60 D115 E116 M119 G123 S124 W126 D127 T128 D129
Binding residue
(residue number reindexed from 1)
H4 P5 Q7 I36 W40 D95 E96 M99 G103 S104 W106 D107 T108 D109
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 00:33:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3hxi', asym_id = 'A', bs = 'BS01', title = 'Structural insights into parasite EIF4E binding specificity for m7G and m2,2,7G mRNA cap.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3hxi', asym_id='A', bs='BS01', title='Structural insights into parasite EIF4E binding specificity for m7G and m2,2,7G mRNA cap.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003723,0003743,0005737,0006413', uniprot = '', pdbid = '3hxi', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003743,0005737,0006413', uniprot='', pdbid='3hxi', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>