Structure of PDB 3hxg Chain A Binding Site BS01

Receptor Information

>3hxg Chain A (length=183) Species: 6183 (Schistosoma mansoni)

EFPHPLQDSWSYYLFQFRKALDWDECLEKVATFSTIEDFWSVLTHTVRPR
EITYGKDLYMFKSDIMPKWEDPKNENGGRWLINVTARQDVDFLWDELLML
LIGSDWDTDEEDRQICGAVFQPRSRGSKLSVWLTSDNEEETILSIGRRIK
ERLELEDTIYFQPVSDQRSQTRGSDICTGKYEI

Ligand information

>3hxg Chain C (length=15) Species: 9606 (Homo sapiens)

GRIIYDRKFLMECRN

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3hxg Structural insights into parasite EIF4E binding specificity for m7G and m2,2,7G mRNA cap.
• Resolution: 2.1 Å
• Binding residue (original residue number in PDB): H24 P25 Q27 I56 W60 E116 M119 G123 S124 W126 D127 T128 D129
• Binding residue (residue number reindexed from 1): H4 P5 Q7 I36 W40 E96 M99 G103 S104 W106 D107 T108 D109

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 17:28:02 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3hxg', asym_id = 'A', bs = 'BS01', title = 'Structural insights into parasite EIF4E binding specificity for m7G and m2,2,7G mRNA cap.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3hxg', asym_id='A', bs='BS01', title='Structural insights into parasite EIF4E binding specificity for m7G and m2,2,7G mRNA cap.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003723,0003743,0005737,0006413', uniprot = '', pdbid = '3hxg', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003743,0005737,0006413', uniprot='', pdbid='3hxg', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>