Structure of PDB 3hs9 Chain A Binding Site BS01

Receptor Information
>3hs9 Chain A (length=233) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFA
IQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQ
VAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQI
KECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELR
IQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3hs9 Regulation of synaptic vesicle recycling by complex formation between intersectin 1 and the clathrin adaptor complex AP2.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		A754 Q756 F757 N758 Q804 V805 A806 V813 Y815
Binding residue
(residue number reindexed from 1)		A50 Q52 F53 N54 Q100 V101 A102 V109 Y111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0030117 membrane coat
GO:0030131 clathrin adaptor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3hs9, PDBe:3hs9, PDBj:3hs9
PDBsum3hs9
PubMed20160082
UniProtP62944|AP2B1_RAT AP-2 complex subunit beta (Gene Name=Ap2b1)

[Back to BioLiP]