Structure of PDB 3hs8 Chain A Binding Site BS01

Receptor Information

>3hs8 Chain A (length=238) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFL
NFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPV
LNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEV
QNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQI
GCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF

Ligand information

>3hs8 Chain P (length=12) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PNNWADFSSTWP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3hs8 Regulation of synaptic vesicle recycling by complex formation between intersectin 1 and the clathrin adaptor complex AP2.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	E702 V715 E718 G725 L726 K727 F740 G742 N743 G780 A781 Q782
Binding residue (residue number reindexed from 1)	E2 V15 E18 G25 L26 K27 F40 G42 N43 G80 A81 Q82

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006886	intracellular protein transport
GO:0016192	vesicle-mediated transport

	Cellular Component
GO:0030117	membrane coat
GO:0030131	clathrin adaptor complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3hs8, PDBe:3hs8, PDBj:3hs8
PDBsum	3hs8
PubMed	20160082
UniProt	P17427\|AP2A2_MOUSE AP-2 complex subunit alpha-2 (Gene Name=Ap2a2)

[Back to BioLiP]